PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0034s0063.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 829aa    MW: 88995.6 Da    PI: 6.2851
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0034s0063.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.61.4e-28297350155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0034s0063.1.p 297 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKKILELMSVHGLTRENVASHLQKYRL 350
                           79*******************.********************************8 PP

2Response_reg78.62.1e-261102181109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+p+ +++l ++l++  y +v+++  +++alell+e +  +Dl++ D+ mp+mdG++ll+     e++lp+i++++ ge + + 
  Sphfalx0034s0063.1.p 110 VLVVDDDPICLMILDRMLRQCSY-QVTTCGRATKALELLREVKdkFDLVISDVYMPDMDGFKLLELVGL-EMDLPVIMMSSDGETSAVM 196
                           89*********************.***************776668*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+  eel++
  Sphfalx0034s0063.1.p 197 KGITHGACDYLLKPVRLEELRN 218
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.99E-36107232IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-43107244No hitNo description
SMARTSM004481.7E-31108220IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.42109224IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-23110219IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.32E-28111223No hitNo description
SuperFamilySSF466891.76E-19294354IPR009057Homeodomain-like
PROSITE profilePS5129411.509294353IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-29296355IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24297350IPR006447Myb domain, plants
PfamPF002494.7E-7299349IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MHHSPIAVCT TMVGEELSRS RVGVGDLGSA MASLQQQQPL VVMSGGQQQH QQHQQQQCGS  60
ATNSSHNATS THGIITTNLH HNNNTTTRAS DGFGKMDNPA VDEFPAGLRV LVVDDDPICL  120
MILDRMLRQC SYQVTTCGRA TKALELLREV KDKFDLVISD VYMPDMDGFK LLELVGLEMD  180
LPVIMMSSDG ETSAVMKGIT HGACDYLLKP VRLEELRNIW QHVVRKKRNE AKDVEHSTSH  240
EDAERHKRGG AGDDADYTSS ATDTTDGNCK LTKRKKEFKE EDDDNEQEND DPSTLKKPRV  300
VWSVELHQQF VSAVNQLGID KAVPKKILEL MSVHGLTREN VASHLQKYRL YLRRLSGVTS  360
QQNGMNMTFG GSETFGNLSS LDGISDLRTL AASGQLSPQT LAALHANMIS RVGMPNGMGL  420
PSSLDPSVLA HALQNVPLPR PQMDGALLAN QSGMAQSIPG PPVLDVDPHL QPHHLSAMGQ  480
LSQLDDMPGL RALQHQLAGA CASNSNGIGL NNPLGGSSGN LVASSNNESL MMQLLQQRVQ  540
QQQQGGGLSV NVPQPSAVLG SPRLLSTDMN LGQAGSLTNM GRGPGSSSLR MPGGASVPHS  600
LGSLFRPTGS GVQALNPVCS SGGSFSGSTT VLSPRSGGVP GCPPATDDMA RSQHSMRTSL  660
NPLGQATRGH EQVLSQSSRP TWLGSQGGMI SGEHGQSIES GLSQFPSQSQ THASGFAGNV  720
RQQSQPEYTS RGMNFPVRLG LDVRPLFDGS SQSHSEQQPT TDIEQKLPKD ERASDNVVIT  780
KLVDGGMVSH DQSEDLLNFF FKQSHEGMSF PDSELASDGY TMDNFYVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-21296356464ARR10-B
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S10_278V6.11e-177(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-114response regulator 2